PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G0140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 254aa    MW: 28863.4 Da    PI: 7.4225
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G0140genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed++l+++++ +G g W+  +++ g++R++k+c++rw++yl
      Gh_A07G0140 14 KGAWTANEDQILKNYITIHGEGKWRDLPQKAGLKRCGKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.42.6e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + eE+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
      Gh_A07G0140  67 RGNISIEEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                      678889****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.576961IPR017930Myb domain
SuperFamilySSF466898.41E-2912108IPR009057Homeodomain-like
SMARTSM007173.0E-111363IPR001005SANT/Myb domain
PfamPF002491.2E-131461IPR001005SANT/Myb domain
CDDcd001672.91E-81661No hitNo description
PROSITE profilePS5129425.05462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2465116IPR009057Homeodomain-like
SMARTSM007179.4E-1566114IPR001005SANT/Myb domain
PfamPF002491.9E-1467112IPR001005SANT/Myb domain
CDDcd001671.36E-780112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGRRPCCAKE GLNKGAWTAN EDQILKNYIT IHGEGKWRDL PQKAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SIEEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLSKRMQGQK  120
RNISPNTPQV SSHNVIRTKA VKCTKAVNVD TLDPKSETLV NSPSETPSSS AINEDNTNNN  180
SMDFLVDFDI NELLAFEYNA IPELYRTQNG GDKMGNNVAD NGEYSHGTEF CQAGEHLDLR  240
GLESYLNLED EWIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.80810.0boll| embryo| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362850.0AF336285.1 Gossypium hirsutum GHMYB38 (ghmyb38) mRNA, complete cds.
GenBankFJ1980510.0FJ198051.1 Gossypium barbadense agamous-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480520.11e-175PREDICTED: transcription factor TT2-like
SwissprotQ9FJA22e-64TT2_ARATH; Transcription factor TT2
TrEMBLA0A0B0PYE50.0A0A0B0PYE5_G
STRINGVIT_11s0016g01320.t019e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.13e-54myb domain protein 3